In principle, an effective vaccine must first trigger innate immune responses sufficient
to train adaptive, antigen-specific T and B cell responses, which,
depending on the vaccine platform, can elicit systemic or localized immunologic memory. In the case of respiratory infection like COVID, a faulty and irrelevant focus on systemic -adaptive immunity has absolutely no role in preventing, neutralising and managing the infectionsand the resulting illness. We often ignore the fact that the influence of the pathogen and the illness associated with it is confined, to the upper respiratory tract (URT),
also referred to as the conducting airways, includes the nasal cavity, pharynx, and larynx. Then descending into the lung, the lower respiratory tract (LRT) which includes
the trachea, the bronchi and bronchiole branches of the lung. While the URT is protected by nasal-associated lymphoid tissue (NALT; cervical lymph nodes), the LRT is protected by the bronchial-associated lymphoid tissue (BALT; mediastinal lymph nodes), the two localised adaptive immune response sites responsible for preventing and neutralising the pathogen.
So, the vaccine is not only an ill-designed product, but conceptually an ill-fit product for the purpose - preventing infection from a respiratory virus. It cannot be that the vaccine people hadn’t known this, they simply ignored it, confidence in the knowledge that no one would dig it up. And they won. Why didn’t this kind of clean biological explanation come out of some learned doctors when, within weeks of the virus break out, the chorus for the vaccine was also breaking out ? This is more a mystery than the biology of either the virus or the disese or even the vaccine. For common folks like me, there were other more serious mysteries. 1. Where in the world is written that a live spread can be stopped only by a vaccine, yet unavailable ? 2. Where in the world is written a new viral illness can be stopped only by a new anti viral, yet unavailable then ? 3. What was wrong with trying known medicines, when most of early symptoms were familiar ones ? 4. Did not the doctors know that known symptoms handled with known medicines, like anti histamines, would be half the battle won by the body so that it can then concentrate entirely on eliminating the virus ? 5. Did not the doctors know that with some success as above with early treatments, people can be saved from serious illness, hospitalisation and even deaths ? 6. With no action on 3,4& 5, the people developing the infection and illness were left with no treatments, until many of them progressed into a serious state. What kind of medical ethics is this, not attempting to treat the early patients with whatever clinical help that was on hand ?
I can add a few more questions. This pandemic was a total clinical failure including the priority of ill
Undermining and discrediting the evolutionary biology of the human immune system and the integrated nature of its innate and acquired components. It's competancy and orchestration is inherent to the nature and site of contact within the host. To add fuel to the fire the blissful
blindness and deafening silence among the fraternity continued, when the definition of vaccine was changed and it's indication repurposed for convenience. From that of preventive to that reducing the severity of the illness. After the primary clinical end point of vaccine trial failed when infection and transmission continued to occur in the vaccinated.
There are other issues unclear about the vaccines as well. Use of N- methyl pseudo uridine for the design of the m-RNA and the inflammatory after effects, use of synthetic cationic lipids for the nano envelope based on industrial glycols rather than naturally occurring glycerides including phosphatides for total safety, choice of the spike protein segment as the target of creation for the m-RNA inside the cells rather than the non pathogenic parts of the virus. In fact, the choice of spike proteins could have necessitated the use of synthetic cationic lipids. Theoretically other safer sets of target proteins and shell lipids were possible. You may recall that the Nobel Prize work on the use of pseudouridine in place of uridine for the m-RNA was precisely to avoid inflammatory effects. It is very likely that they too tried N-methyl pseudouridine, as part of studying various substituted uridines, and found it unsuitable.
Nobel work used pseudo uridine in place of uridine to overcome inflammatory overhangs. Vaccine developers used N-methyl pseudouridine, for what reason we do not know. Both these m-RNA work almost identical, but the end results are vastly different - just a methyl group. In organic chemistry, a simple methyl substitution can cause from negligible effects to substantial effects in the properties between the parent molecule and the methyl substituted one. This is a chemistry that, with pseudouridine, can be authentically commented upon only the Nobel scientists. Science beckons them.
It was a very animated presentation by Dr. McMillan. I am sure he would recall the early days in 2020 when BCG vaccines were recommended for mass use to prevent the spread. Apparently some promising results were available from a quick research. We know how this promise was quickly and prematurely shut and why. One point I read later was that the BCG vaccines provided lot of general cells like T cells, unlike the m-RNA vaccines which provided only specific antibodies, specific to the coded variant in the vaccine, the first one. A permanent limitation of m-RNA vaccines. It seems MMR vaccines also provide similar benefits like that of BCG.. Anyway, at population level, another mass vaccination is unrealistic, leaving aside the issue of convincing medical administrations. Despite the fact that the biology involved in this proposal could make it a text book quality one. My request and advice. Please concentrate just on early treatments of the affected/infected with old school medicines, now that the FDA has withdrawn its opposition to Ivermectin. This focus, only on a few in a large population, is the most practical one and the most effective one. It can eventually stop the spread in the population ( fresh infection) for fraction of a cost and bother over that of another round of mass vaccinations. It will also let the immune system heal/correct itself in time.
This is all very well but can you see GP's dishing out MMR jabs on the pretext that you have a Covid infection - about as much chance as getting Ivermectin off them. If you are in line for an MMR booster then maybe you will have a chance but that's only if they can check when you had your first one
How many adults get measles, mumps or rubella? In the USA, anyone born in the late forties or fifties had natural occurring measles, mumps and rubella. The next generation were immunised. I have never in my forty years as an RN seen any adult in the USA with measles, mumps or rubella.
Why in god’s name would you give this vaccine to any adult who has had natural occurring infection, or who has been immunised. This to me borders on crazy.
Geert is trying to fight fire with fire. God bless him for coming up with ideas to preserve lives. I personally think that not many people will take any vaccine ever again. No vaccine these days is exempt from suspicion. The pharmaceutical world has already stated that it intends to convert all existing vaccines to mRNA platforms.
And the MMR all in one shot is way more dangerous than 3 separate shots! Oh Geert, you still really love vaccines don't ya? Besides, Dr McMillan is right, there is not enough lymphocytes and NK cells.
He's not notorious. If millions of Human beings had listened to what he was saying back in 2020 then their bloody immune systems wouldn't be collapsing now
the problem is, he never mentioned GENE MODIFICATION TREATMENTS, instead of 'covid vaccines'... He very carefully used the FDA/CD/NIH forced redefinitions of
vaccines, which were NONE, in case of covid injections.... So when Geert talks about 'vaccines'.. Oh, the good old vaccines for something SO scary like covid!?? Why not to take it then!?? Great, Geert (how similar...) you've done it, so well! I would put you together with Trump and Biden in one compartment, with shared toilet, which would be cleaned by Fauci, every morning. And around noon, everybody would go to work, in the toilet paper factory...
IMO by referring to the shots as “vaccines” and not doubting official good intentions, but rather classifying the decisions as incompetency, Geert has been hoping to position himself as a credible scientists in the clown world.
He is not necessarily controlled, but unable or afraid to call the mega conspiracy by it’s name.
The DOD has been planning this for decades... there is no way they will be stopped...
And because it is necessary -- it should not be stopped:
Conventional Oil Sources peaked in 2008 and the Shale binge has now spoiled US reserves, top investor warns Financial Times.
Preface. Conventional crude oil production may have already peaked in 2008 at 69.5million barrels per day (mb/d) according to Europe’s International Energy Agency (IEA 2018 p45). The U.S. Energy Information Agency shows global peak crude oil production at a later date in 2018 at 82.9mb/d (EIA 2020) because they included tight oil, oil sands, and deep-sea oil. Though it will take several years of lower oil production to be sure the peak occurred. Regardless, world production has been on a plateau since 2005.
What’s saved the world from oil decline was unconventional tight “fracked” oil, which accounted for 63% of total U.S. crude oil production in 2019 and 83% of global oil growth from 2009 to 2019. So it’s a big deal if we’ve reached the peak of fracked oil, because that is also the peak of both conventional and unconventional oil and the decline of all oil in the future.
Good effort, but you know most people will be wondering what oil has to do with it. And if you believe it's a depopulation thing, why would the DOD wait so long, while the population skyrockets and oil depletes? Besides, unless Geert is right it hasn't worked, has it?
I could stand on a street corner shouting truth bombs and the herds of barnyard and circus animals as they pass by busy with their pointless lives...
Or I can do it here....
I choose here... cuz it's more convenient... and from time to time there are readers who distinguish themselves from the barnyard and circus animals...
because there is a huge number of Families Worldwide that have a mix of Vaccinated and Unvaccinated and you can imagine the angst that is being caused there. It was a masterful PsyOp and the People that mastered and are still perpetuating need to be chased down and sorted.
Those who have changed their minds ... are few and far between.
I am amused at how the Vaxxers behave like monkeys -- now that the cool thing to do is start a gofundme to pay for the funerals of the vax dead -- they are all doing it... hahaha idiots
Many had little choice. And North America, or the West, isn't the world. I've never been under any pressure to get it. A lot of people were scared into behaving irrationally, some incredibly nastily. Don't generalize.
There was always choice. Nobody put a gun to anyone's head... nobody held anyone down and jammed a needle into their arm.
BTW - when I suspected they might actually do this ... I purchased enough plywood to board up the ground floor of our house... and I added multiple firearms to the arsenal and a few more crates of ammo.... If anyone thought they were gonna inject me ... I'd be taking some of them along with me... those left alive would have to inject my dead body.
As for those who were scared... f789 them... they are stupid... everyone knows you cannot create safe pharma in a matter of months ... there was NO long term testing...
Yet they injected. F789 them ... morons.
BTW a Vaxxer sent me an cartoon photo of someone having injected every other vax but refusing the Covid shot --- clearly mocking me --- and my response was -- where's the long term tests for this?
No reply.
F789 that idiot too... he's a mate but I'd not shed a single tear if he dropped with an injury...
I agree with your sentiments regarding the so-called vaccines, and it didn't take long to arrive at my conclusion, but I'm sure some people didn't get a choice. The elderly in nursing homes and hospital patients would often be mentally or physically unable to give their consent. Then there are children. I suppose, like me, you were under no financial or familial pressure. That's all before one considers the mass brainwashing, and how trusting and/or dumb many people are.
I know you're a person who holds fairly firm views on issues, so I suppose this comment is primarily for other readers. Don't forget to keep the safety catch on.
The half dead people in nursing homes were done a favour...
I once visited an aunt in one of these places.. it stunk of shit and piss... I couldn't wait for the visit to end... I can't imagine being stuck their till death.... I'd welcome a shot of the Rat Juice if it ended the misery ... hell I'd be quite keen on some Midazolam!
I play saxophone and during official pandemic they said we’re not allowed to play saxophone because it spreads the virus but “Humming Heroes” talks about how this kind of humming in a mouthpiece protects against the virus?
Many many thanks to Geert for persisting with educating us regarding this pandemic. I’m just a simple human who cares about humanity. Geert has become to me like a much loved wise uncle. Even if Geert is just a little bit wrong I will be eternally thankful for his concern and taking so much time to tell us these things.
As much as I appreciate GVB`s great work and intention to propose a mean to mitigate the harmful effect of the genetic inoculations in regard to the alleged pandemic, I do not think injecting yet another pharmaceutical product will be a plausible solution for the majority of C-19 vaccinees given a number of circumstances that I will not discuss here. In my humble opinion, if I were a multiple C-19 vaccinee, I would seek out the possibility of getting an infection from the wild type measles virus in an attempt to retrain the immune system. Admittedly without being enlightened with the wast ocean of experience and knowledge possessed by GVB and others, I fail to see why not the naturally occurring measles infection, transmitted from person to person via mucous membranes, and further responses from the innate immune system on the naturally occurring virus would yield a more robust and well adapted "retraining" than the effects of a more potentially harmful injection of the MMR vaccine. Any thoughts?
If one comes to the conclusion based on the data that there was no risk additive pathogen (see Rancourt, Hudson etc..), then Geert's proposal makes no sense. People have been hurt enough through transfection. They don't need further insults to their bodies.
In regard to borders, we have an illegal UN invasion everywhere, directed by Gates paid BLM resources.... That excludes any possibility of reaction. In terms of Geert, a PHARMA 'expert', there is nothing what he says what makes sense, sorry. On top of it, the current PATENTED MMR is mod mRNA, GENE THERAPY AGAIN, which is supported by Trump, and thus makes Geert a good candidate for a lethal duo.. That entire explanation misses the no 1 fact, which only you noticed, LACK OF LYMPHOCYTES, T-cells, exactly like in HIV!!!! Why??? Because when you look at the T-cells CD4 glyco-receptor, it does have a sequence:
and these 2 favorite Spike fragments, are not even found by the NIH pharma owned BLAST software package, so doing it by hand and using my eyes...:
WWQAERASSSKSWITFDLKNKE <<<<CD4
HRSYLTPGDSSSGWTAGAAAYYV <<<<Spike
or this one
LFIGLGIFFCVRCRHRRRQ <<<CD4
LFLP---FFSNVTWFHAIH <<<Spike
and SO many MORE fragments!!! If you intend to GENETICALLY REPROGRAM YOUR HUMAN BODY in order to destroy it, what would you attack first? The surface glycoprotein from the T-cells, while making the Spike SO SIMILAR to CD4, that your body doesn't 'have time' to produce the CD4's due to stealing all the amino acids (many of them neurotransmitters...) for the SYNTHETIC production of a NON-HUMAN EUA 'approved' crime!!!
Once again, G. Vanden Bossche (Pharma insider) is a CRIMINAL fellow, like Gates (to hell), whose one goal only, is to inject people with lethal concoctions, under the false pretext of trying to safe their lives! Lives?? How does it feel like to be genetically modified???? Just my opinions....
We need the population to improve their own immune systems through food, sleep and Vits D and C and zinc
and the number one, Exercise
if you can...
In principle, an effective vaccine must first trigger innate immune responses sufficient
to train adaptive, antigen-specific T and B cell responses, which,
depending on the vaccine platform, can elicit systemic or localized immunologic memory. In the case of respiratory infection like COVID, a faulty and irrelevant focus on systemic -adaptive immunity has absolutely no role in preventing, neutralising and managing the infectionsand the resulting illness. We often ignore the fact that the influence of the pathogen and the illness associated with it is confined, to the upper respiratory tract (URT),
also referred to as the conducting airways, includes the nasal cavity, pharynx, and larynx. Then descending into the lung, the lower respiratory tract (LRT) which includes
the trachea, the bronchi and bronchiole branches of the lung. While the URT is protected by nasal-associated lymphoid tissue (NALT; cervical lymph nodes), the LRT is protected by the bronchial-associated lymphoid tissue (BALT; mediastinal lymph nodes), the two localised adaptive immune response sites responsible for preventing and neutralising the pathogen.
Excellent points.
So, the vaccine is not only an ill-designed product, but conceptually an ill-fit product for the purpose - preventing infection from a respiratory virus. It cannot be that the vaccine people hadn’t known this, they simply ignored it, confidence in the knowledge that no one would dig it up. And they won. Why didn’t this kind of clean biological explanation come out of some learned doctors when, within weeks of the virus break out, the chorus for the vaccine was also breaking out ? This is more a mystery than the biology of either the virus or the disese or even the vaccine. For common folks like me, there were other more serious mysteries. 1. Where in the world is written that a live spread can be stopped only by a vaccine, yet unavailable ? 2. Where in the world is written a new viral illness can be stopped only by a new anti viral, yet unavailable then ? 3. What was wrong with trying known medicines, when most of early symptoms were familiar ones ? 4. Did not the doctors know that known symptoms handled with known medicines, like anti histamines, would be half the battle won by the body so that it can then concentrate entirely on eliminating the virus ? 5. Did not the doctors know that with some success as above with early treatments, people can be saved from serious illness, hospitalisation and even deaths ? 6. With no action on 3,4& 5, the people developing the infection and illness were left with no treatments, until many of them progressed into a serious state. What kind of medical ethics is this, not attempting to treat the early patients with whatever clinical help that was on hand ?
I can add a few more questions. This pandemic was a total clinical failure including the priority of ill
suited vaccines.
Undermining and discrediting the evolutionary biology of the human immune system and the integrated nature of its innate and acquired components. It's competancy and orchestration is inherent to the nature and site of contact within the host. To add fuel to the fire the blissful
blindness and deafening silence among the fraternity continued, when the definition of vaccine was changed and it's indication repurposed for convenience. From that of preventive to that reducing the severity of the illness. After the primary clinical end point of vaccine trial failed when infection and transmission continued to occur in the vaccinated.
There are other issues unclear about the vaccines as well. Use of N- methyl pseudo uridine for the design of the m-RNA and the inflammatory after effects, use of synthetic cationic lipids for the nano envelope based on industrial glycols rather than naturally occurring glycerides including phosphatides for total safety, choice of the spike protein segment as the target of creation for the m-RNA inside the cells rather than the non pathogenic parts of the virus. In fact, the choice of spike proteins could have necessitated the use of synthetic cationic lipids. Theoretically other safer sets of target proteins and shell lipids were possible. You may recall that the Nobel Prize work on the use of pseudouridine in place of uridine for the m-RNA was precisely to avoid inflammatory effects. It is very likely that they too tried N-methyl pseudouridine, as part of studying various substituted uridines, and found it unsuitable.
Nobel work used pseudo uridine in place of uridine to overcome inflammatory overhangs. Vaccine developers used N-methyl pseudouridine, for what reason we do not know. Both these m-RNA work almost identical, but the end results are vastly different - just a methyl group. In organic chemistry, a simple methyl substitution can cause from negligible effects to substantial effects in the properties between the parent molecule and the methyl substituted one. This is a chemistry that, with pseudouridine, can be authentically commented upon only the Nobel scientists. Science beckons them.
NO MORE SHOTS!
It was a very animated presentation by Dr. McMillan. I am sure he would recall the early days in 2020 when BCG vaccines were recommended for mass use to prevent the spread. Apparently some promising results were available from a quick research. We know how this promise was quickly and prematurely shut and why. One point I read later was that the BCG vaccines provided lot of general cells like T cells, unlike the m-RNA vaccines which provided only specific antibodies, specific to the coded variant in the vaccine, the first one. A permanent limitation of m-RNA vaccines. It seems MMR vaccines also provide similar benefits like that of BCG.. Anyway, at population level, another mass vaccination is unrealistic, leaving aside the issue of convincing medical administrations. Despite the fact that the biology involved in this proposal could make it a text book quality one. My request and advice. Please concentrate just on early treatments of the affected/infected with old school medicines, now that the FDA has withdrawn its opposition to Ivermectin. This focus, only on a few in a large population, is the most practical one and the most effective one. It can eventually stop the spread in the population ( fresh infection) for fraction of a cost and bother over that of another round of mass vaccinations. It will also let the immune system heal/correct itself in time.
I would tend to agree.
Thanks for sharing this Dr McMillan 🙏
Welcome.
I am SO grateful for Geert !
Why? This recommendation makes zero sense and will actually harm more peoplE.
This is all very well but can you see GP's dishing out MMR jabs on the pretext that you have a Covid infection - about as much chance as getting Ivermectin off them. If you are in line for an MMR booster then maybe you will have a chance but that's only if they can check when you had your first one
How many adults get measles, mumps or rubella? In the USA, anyone born in the late forties or fifties had natural occurring measles, mumps and rubella. The next generation were immunised. I have never in my forty years as an RN seen any adult in the USA with measles, mumps or rubella.
Why in god’s name would you give this vaccine to any adult who has had natural occurring infection, or who has been immunised. This to me borders on crazy.
Geert is trying to fight fire with fire. God bless him for coming up with ideas to preserve lives. I personally think that not many people will take any vaccine ever again. No vaccine these days is exempt from suspicion. The pharmaceutical world has already stated that it intends to convert all existing vaccines to mRNA platforms.
And the MMR all in one shot is way more dangerous than 3 separate shots! Oh Geert, you still really love vaccines don't ya? Besides, Dr McMillan is right, there is not enough lymphocytes and NK cells.
Notorious GVB
He's not notorious. If millions of Human beings had listened to what he was saying back in 2020 then their bloody immune systems wouldn't be collapsing now
GVB is controlled opposition. Knew it from his first video. His proposal for the vaxxed to get an MMR vaccine is the shoe dropping.
Definitely not
Comments not working properly.
the problem is, he never mentioned GENE MODIFICATION TREATMENTS, instead of 'covid vaccines'... He very carefully used the FDA/CD/NIH forced redefinitions of
vaccines, which were NONE, in case of covid injections.... So when Geert talks about 'vaccines'.. Oh, the good old vaccines for something SO scary like covid!?? Why not to take it then!?? Great, Geert (how similar...) you've done it, so well! I would put you together with Trump and Biden in one compartment, with shared toilet, which would be cleaned by Fauci, every morning. And around noon, everybody would go to work, in the toilet paper factory...
IMO by referring to the shots as “vaccines” and not doubting official good intentions, but rather classifying the decisions as incompetency, Geert has been hoping to position himself as a credible scientists in the clown world.
He is not necessarily controlled, but unable or afraid to call the mega conspiracy by it’s name.
Why would anyone want to help the vaxxed?
Because if they all die or get severely sick we are all going to be in big trouble. They are the majority, the unvaccinated are a small minority.
The DOD has been planning this for decades... there is no way they will be stopped...
And because it is necessary -- it should not be stopped:
Conventional Oil Sources peaked in 2008 and the Shale binge has now spoiled US reserves, top investor warns Financial Times.
Preface. Conventional crude oil production may have already peaked in 2008 at 69.5million barrels per day (mb/d) according to Europe’s International Energy Agency (IEA 2018 p45). The U.S. Energy Information Agency shows global peak crude oil production at a later date in 2018 at 82.9mb/d (EIA 2020) because they included tight oil, oil sands, and deep-sea oil. Though it will take several years of lower oil production to be sure the peak occurred. Regardless, world production has been on a plateau since 2005.
What’s saved the world from oil decline was unconventional tight “fracked” oil, which accounted for 63% of total U.S. crude oil production in 2019 and 83% of global oil growth from 2009 to 2019. So it’s a big deal if we’ve reached the peak of fracked oil, because that is also the peak of both conventional and unconventional oil and the decline of all oil in the future.
Some key points from this Financial Times article: https://energyskeptic.com/2021/the-end-of-fracked-shale-oil/
Shale boss says US has passed peak oil | Financial Times https://archive.ph/tjl6J
Meet The Gator: Growing Energy Demand https://thehonestsorcerer.substack.com/p/meet-the-gator-growing-energy-demand
Our fossil fuel energy predicament, including why the correct story is rarely told
https://ourfiniteworld.com/2021/11/10/our-fossil-fuel-energy-predicament-including-why-the-correct-story-is-rarely-told/
https://ourfiniteworld.com/2023/06/30/the-world-economy-is-becoming-unglued-models-miss-real-world-behavior/
MORE - https://www.headsupster.com/forumthread?shortId=220
Good effort, but you know most people will be wondering what oil has to do with it. And if you believe it's a depopulation thing, why would the DOD wait so long, while the population skyrockets and oil depletes? Besides, unless Geert is right it hasn't worked, has it?
Most people are barnyard and circus animals ... what they think is of no concern to me...
GVB will be right ... that is certain
GVB did not invent this theory -- it existed long before Covid https://duckduckgo.com/?q=danger+of+deploying+leaky+vaccines&df=2000-01-01..2019-01-01&ia=web
If you don't care what most people think I'm not sure why you bothered providing those here with so much vital information.
I could stand on a street corner shouting truth bombs and the herds of barnyard and circus animals as they pass by busy with their pointless lives...
Or I can do it here....
I choose here... cuz it's more convenient... and from time to time there are readers who distinguish themselves from the barnyard and circus animals...
https://www.headsupster.com/forumthread?shortId=220
https://www.headsupster.com/forumthread?shortId=4824
because there is a huge number of Families Worldwide that have a mix of Vaccinated and Unvaccinated and you can imagine the angst that is being caused there. It was a masterful PsyOp and the People that mastered and are still perpetuating need to be chased down and sorted.
Because not all of them were assholes, Eddy.
Most were... most wanted me dead.
They still do.
Those who have changed their minds ... are few and far between.
I am amused at how the Vaxxers behave like monkeys -- now that the cool thing to do is start a gofundme to pay for the funerals of the vax dead -- they are all doing it... hahaha idiots
Many had little choice. And North America, or the West, isn't the world. I've never been under any pressure to get it. A lot of people were scared into behaving irrationally, some incredibly nastily. Don't generalize.
There was always choice. Nobody put a gun to anyone's head... nobody held anyone down and jammed a needle into their arm.
BTW - when I suspected they might actually do this ... I purchased enough plywood to board up the ground floor of our house... and I added multiple firearms to the arsenal and a few more crates of ammo.... If anyone thought they were gonna inject me ... I'd be taking some of them along with me... those left alive would have to inject my dead body.
As for those who were scared... f789 them... they are stupid... everyone knows you cannot create safe pharma in a matter of months ... there was NO long term testing...
Yet they injected. F789 them ... morons.
BTW a Vaxxer sent me an cartoon photo of someone having injected every other vax but refusing the Covid shot --- clearly mocking me --- and my response was -- where's the long term tests for this?
No reply.
F789 that idiot too... he's a mate but I'd not shed a single tear if he dropped with an injury...
Like I said... f789 the Vaxxers
I agree with your sentiments regarding the so-called vaccines, and it didn't take long to arrive at my conclusion, but I'm sure some people didn't get a choice. The elderly in nursing homes and hospital patients would often be mentally or physically unable to give their consent. Then there are children. I suppose, like me, you were under no financial or familial pressure. That's all before one considers the mass brainwashing, and how trusting and/or dumb many people are.
I know you're a person who holds fairly firm views on issues, so I suppose this comment is primarily for other readers. Don't forget to keep the safety catch on.
The half dead people in nursing homes were done a favour...
I once visited an aunt in one of these places.. it stunk of shit and piss... I couldn't wait for the visit to end... I can't imagine being stuck their till death.... I'd welcome a shot of the Rat Juice if it ended the misery ... hell I'd be quite keen on some Midazolam!
Me because I’m married to one. And my mother and sister have had it too.
Try suggesting they take Ivermectin... let me know how that goes
https://www.mdpi.com/2076-3921/11/9/1785
I play saxophone and during official pandemic they said we’re not allowed to play saxophone because it spreads the virus but “Humming Heroes” talks about how this kind of humming in a mouthpiece protects against the virus?
Many many thanks to Geert for persisting with educating us regarding this pandemic. I’m just a simple human who cares about humanity. Geert has become to me like a much loved wise uncle. Even if Geert is just a little bit wrong I will be eternally thankful for his concern and taking so much time to tell us these things.
As much as I appreciate GVB`s great work and intention to propose a mean to mitigate the harmful effect of the genetic inoculations in regard to the alleged pandemic, I do not think injecting yet another pharmaceutical product will be a plausible solution for the majority of C-19 vaccinees given a number of circumstances that I will not discuss here. In my humble opinion, if I were a multiple C-19 vaccinee, I would seek out the possibility of getting an infection from the wild type measles virus in an attempt to retrain the immune system. Admittedly without being enlightened with the wast ocean of experience and knowledge possessed by GVB and others, I fail to see why not the naturally occurring measles infection, transmitted from person to person via mucous membranes, and further responses from the innate immune system on the naturally occurring virus would yield a more robust and well adapted "retraining" than the effects of a more potentially harmful injection of the MMR vaccine. Any thoughts?
If one comes to the conclusion based on the data that there was no risk additive pathogen (see Rancourt, Hudson etc..), then Geert's proposal makes no sense. People have been hurt enough through transfection. They don't need further insults to their bodies.
Dr. McMillan,
In regard to borders, we have an illegal UN invasion everywhere, directed by Gates paid BLM resources.... That excludes any possibility of reaction. In terms of Geert, a PHARMA 'expert', there is nothing what he says what makes sense, sorry. On top of it, the current PATENTED MMR is mod mRNA, GENE THERAPY AGAIN, which is supported by Trump, and thus makes Geert a good candidate for a lethal duo.. That entire explanation misses the no 1 fact, which only you noticed, LACK OF LYMPHOCYTES, T-cells, exactly like in HIV!!!! Why??? Because when you look at the T-cells CD4 glyco-receptor, it does have a sequence:
https://www.uniprot.org/uniprotkb/P01730/entry
which aligns with the HIV-1 Rev :
Query 39 KNRRRRWRARQNQIHS-ISERILSACLGR 66
++RRR+ R +QI +SE+ C R
Sbjct 423 RHRRRQ-AERMSQIKRLLSEKKTCQCPHR 450
and the HIV-1 TAT proteins
Query 42 GLGISYGRKKRRQRRSA 58
GLGI + + R +RR A
Sbjct 413 GLGIFFCVRCRHRRRQA 429
AND with the SARS-CoV-2 Spike, up to 36% IDENTITIES in amino sequences. Here few examples:
Query 6 PFRHLLLVLQLALLPAATQGKK 27 <=T-cell surface glycoprotein
P+R ++L +L PA G K
Sbjct 507 PYRVVVLSFELLHAPATVCGPK 528 <=SARS-CoV-2 SPIKE INJECTED INTO VICTIMS ARMS!!!
and few more examples, among many:
Query 61 ILGNQGSFLT-----KGPSKLND 78
+L N SF T P+KLND
Sbjct 367 VLYNSASFSTFKCYGVSPTKLND 389
Query 199 IVVLAFQ---KASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWWQAERASSSKSWITFD 255
+VVL+F+ +++ K+ + + + F LTG+G L S+K ++ F
Sbjct 510 VVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVL------TESNKKFLPFQ 563
Query 256 LKNKEVS-VKRVTQDPK 271
++++ +DP+
Sbjct 564 QFGRDIADTTDAVRDPQ 580
and these 2 favorite Spike fragments, are not even found by the NIH pharma owned BLAST software package, so doing it by hand and using my eyes...:
WWQAERASSSKSWITFDLKNKE <<<<CD4
HRSYLTPGDSSSGWTAGAAAYYV <<<<Spike
or this one
LFIGLGIFFCVRCRHRRRQ <<<CD4
LFLP---FFSNVTWFHAIH <<<Spike
and SO many MORE fragments!!! If you intend to GENETICALLY REPROGRAM YOUR HUMAN BODY in order to destroy it, what would you attack first? The surface glycoprotein from the T-cells, while making the Spike SO SIMILAR to CD4, that your body doesn't 'have time' to produce the CD4's due to stealing all the amino acids (many of them neurotransmitters...) for the SYNTHETIC production of a NON-HUMAN EUA 'approved' crime!!!
Once again, G. Vanden Bossche (Pharma insider) is a CRIMINAL fellow, like Gates (to hell), whose one goal only, is to inject people with lethal concoctions, under the false pretext of trying to safe their lives! Lives?? How does it feel like to be genetically modified???? Just my opinions....
Thank you for allowing to post something here;))
Oh, my Goodness! You can't be serious.