42 Comments
User's avatar
Deborah Weaver's avatar

This should come as no surprise, as Nobel Laureate Dr. Luc Montagnier had been reporting this since early 2022, when he had reported he had twenty-one patients who died of a fast-progressing Creutzfeldt-Jakob Disease within five months of their second COVID shots. One took Moderna shots and all others took Pfizer.

https://www.soulask.com/luc-montagnier-they-are-not-vaccines-they-are-poisons-speech-to-the-luxembourg-parliament/

I find it amazing that no medical authority, health agency, government agency, or mainstream media has been mentioning this, even though he reported it in front of the Luxembourg Parliament, and obviously a lot of people in high places must have known what was about to descend upon humanity! It appears everyone has been bought off and as long as people can line their pockets with "blood money", they are not the least bit concerned with the short or long-term welfare of humanity.

Seriously, given that all these vaccines contain sequences that will ultimately lead to this, due to the ongoing Spike Protein production, and the vaccinated are "shedding" ALL their health issues onto the unvaccinated, perhaps we are all doomed. And according to Dr. Ana Maria Mihalcea, all of the blood related issues also appear to be found in pets and even warm-blooded wild animals now!

Don't you just love the idiots who are STILL doing Gain-of-Function Research?

What a freaking disaster. I have been using the above link in many of the COVID vaccine questions I answer on Quora, so there should be others who have known the horrific disaster that is about to descend upon us all...

Mary Renaud's avatar

I have pointed this out on several Substack comments about the statements Dr Luc Montagnier, in 2021-2022, Nobel Winner (2008) for his work in virology (on HIV).

He spoke out publicly in several videos on problems with the CV19 mRNA jabs and the dangers they present specifically: the choice of the spike protein is a fundamental error because it is the most toxic part of the virus, the homology of the spike to other human proteins raising the probability of auto immune disease, and the problems caused in the brain and his worries about CJD/mad cow due to mis-folded proteins in the brain. He said much more.

Most of these videos can now be seen on Rumble while during the ‘pandemic’ they were censored and removed from the net. I was very sorry to see this brilliant man demonized and put-down by TV paid MD’s and commentators, none of whom won a Nobel in anything.

Many believe Montagnier may have been murdered along with other tremendous Truth Tellers who could not be persuaded to LIE.

I am sure they are all with God now and are hearing the words of: job well done, for warning and saving as many of God’s children as they possibly could. I thank them all, as I am sure most of us who are aware do with heartfelt gratitude.

mejbcart's avatar

Montagnier, was invited to the Luxembourg Parliament to accompany petitioners speaking out against compulsory vaccination on Wednesday 12th of January '22.

One month later on February 8, 2022 he is DEAD.

Professor Burkhardt in Mai 2023 gave an interview about his pathological findings, testified before the EU parliament, on the 30st of May 2023, Prof. Arne Burkhardt is DEAD.

There are SERIAL KILLERS in EU 'gov' and NOT one is looking for them. Were are the HUMAN BEINGS on this planet?

Jaz's avatar

True! Dr Vladimir Zelenko on his video said he's not suicidal, few months later died. His protocol was followed by Trump when he had CONVID. Dr Rashid Buttar is poisoned and dead. They said he died of an undisclosed cause. Dr Ariyana Love was poisoned but managed to detox herself. Dr Robert O Young is arrested and imprisoned for curing cancer patients. Dr Reiner Fuellmich (not a medical Dr but a Lawyer) was arrested and imprisoned for exposing CONVID. Yet people are still asleep and the agenda is still been implemented...... Scary!

Deborah Weaver's avatar

Dr. Andreas Noack from Germany, posted a video online shortly he got a Pfizer vial early in the rollout of the shots. AHe said there was defiantly Graphene Oxide in the shots, but not just that. He said there was Graphene Hydroxide, and that it was like putting minute razor blades directly into the blood of the vaccinated that would shred the blood at the capillary level and no one should take it. He was arrested and killed in police custody. *** Also, there was one head of a hospital who supposedly committed suicide in Germany and left a note saying he refused to watch the medical personnel continue medical procedures that were not helping patients with COVID, but were killing them.

mejbcart's avatar

blind and scared sheeple..

Deborah Weaver's avatar

And Dr. Andreas Noack reported finding Graphene HYDROXIDE (not just Graphene Oxide) in the Pfizer COVID shots, basically putting minute razor blades directly into the veins of the COVID vaccinated, shredding their blood vessels at the capillary level. He was arrested by German police shortly after he reported this, and supposedly murdered in police custody, or by "death ray".

https://www.bitchute.com/video/X9oMvf6dbhCi/

https://gatesofvienna.net/2021/12/the-mysterious-death-of-dr-andreas-noack/

A lot of "death following warning humanity" going on!

And these shots are still on the Children's Vaccine Schedule??? And you wonder why babies are dying following vaccination???

Stevie's avatar

Is it better to be in the Dark or know exactly what killed my Spouse of 32 yrs age 56 as I continue to research ( As Shedding of his poisons into me, I fighting for all/any homosassius still!) and all the/ these signs, symptoms form beginning with typical “butterfly rash” after 2 Pfizer followed by a person I never knew/ no longer recognized as his brain went to mush about 1.5 / 2 weeks before massive cardio event expiring him, all @ 6.5 mnth's after injections. Corporate mandates government deceit which is generational BTW / not the first time! & media lies, save Grandma save mom……

Neo's avatar

These animal and human prion diseases are sequenced in labs.

The CWD was made in Colorado at CSU in the late 60s.

A few purposely infected deer escaped the research facility on prospect ave. as well 25ish years ago

. CWD started and spread from and is rampant in Colorado. CSU just built a Bat research facility as well.

The front range of Colorado is the hub for biotech research.

As far as people getting CJD from the shots.

This had to have been done in isolated coordinated batches because of the hot spots it happened in. CJD normally has a long incubation period. These people saw rapid declines right after taking the jim juice and are all for the most part dead.

Turbo CJD...

The wife of the president of the CJD ass. got CJD right after her pointed.health intervention in 21.

He was already the pres. before she got it. IRONY!!

I don't believe all the vxd are going to die from this rare prion.

The likelihood is far greater for them to see cancer, strokes and heart attacks/SADS

Many experimental juices in the strategic stockpile were implemented in the grand experiment of 21

The stuff Dr Ana sees is nothing new. Savvy researchers have seen this for 30 years now in blood.

The connection with what's seen in the un vac blood and vac blood is the cross domain bacteria fibers that are in all humans.

I heavily posit that these fibers were genetically modified with the vx for a hybridized/modified surface protein expression of the CDB microbes encasing filaments found in all Eukaryotes already.

I reached out to Kevin McCairn to explain some of his mistakes to him and he wanted to hear nothing about things he's unaware of that are germane to this research.

This post illustrates what happened in our interactions.

He found the micro biogenesis of the biosynthetic embalmer clotz in his injected hamsters and doesn't even know it.

I point it out here......please easily confirm or try to refute my work.

Factoid: Although >70% of scientific publications are fraudulent with conclusions that can't be replicated. This will be easy to replicate.

https://open.substack.com/pub/neomicroscopy/p/neuroscientist-kevin-mccairn-phd?r=1yb1yj&utm_campaign=post&utm_medium=web&showWelcomeOnShare=false

https://open.substack.com/pub/neomicroscopy/p/fiberous-embalmer-clots-worldwide?r=1yb1yj&utm_campaign=post&utm_medium=web&showWelcomeOnShare=false

On a worldwide scale. Think Hard!!!!!

More people die in a single day from heart attacks than all accounted cases of CJD since its discovery

Deborah Weaver's avatar

If you watch many of the videos posted by Dr. Ana Maria Mihalcea, you can see these tiny “nanobots” self-assembling minute devices in the blood. This is NOT just fibers, this is something completely different happening.

Neo's avatar

Hello Deborah

The blood posts I put out on SS are tantamount to anything anyone is showing in human blood.

I am heavily shadow banned because my work is far outside the Overton window

Dr. Ana would have a nano field day trip with my micrographs…wanna see true micrographs of blood with the debatable chips in single RBC’s and plasma. Go look through my posts. You will see different things you’ve never seen Ana present on.

I can’t imagine what she would say with my micrographs. Yes i can. It’s definitively all nanotech.

Cheers

Neo's avatar

This needs to be understood.

Kevin McCairn is calling the CDB fibers, beta amyloid fibers or even paper towel fibers. This demolishes much credibility on his amyloid ID!!

The CDB fibers are not amyloid fibers or prions. They are living biological organisms that I have cultured and isolated.

The bigger threat to humanity is from the CDB microbe and fibers . Not the CJD prion.

He is wrong and I can easily prove it.

Notice the $250k bet I made with him that he didn't accept in the link posted.

There is also a Kevin McKernan that I have much respect for who approached me in 2012 to sequence my work.

Don't mispronounce or get the 2 names confused. They are 2 different men with different skillsets. McKernan helped map the human genome

Deborah Weaver's avatar

I agree, but from what I have read this prion disease in the shots is “shedding” to the unvaccinated and being found in pets and wildlife in remote areas. Prior to this vaccine rollout, CJD (Creutzfeldt-Jakob Disease) could be spread through blood transfusions but not easily otherwise. Given no one is testing blood for any of the health issues associated with these shots, taking a blood transfusion today is not a safe bet. *** Also, has anyone heard from Dr. Ana Mihalcea recently? She used to have a very active Substack account, but appears to have disappeared.

Cruising Economist's avatar

Wow, widespread misfolded prion infection would exceed the worst of the nightmare scenarios contemplated to date, by a horrific margin. At this point, as I understand it, prion infection while slow acting is untreatable and ultimately extremely lethal. Let's hope the research results are wrong or the prions detected are somehow harmless (not misfolded, hence infectious?).

Note, prions aren't believed to be transmitted through casual contact and there is some resistance to transmission between species though not perfect (be advised, pigs are now being injected with mRNA and cattle may be soon).

Also, if the tested amyloid aggregations (white clots) are only being suffered by those who were COVID injected those who weren't may be free of misfolded prions, if that is in fact what was detected.

Jeanine's avatar

Yes, that was Dr. McCullough's conclusion: it was just the vaccinated.

sadie's avatar

Sadly, it's not. See above.... and there are many studies, even some before the vax was even available, that showed damage to immune system and other ongoing issues.

Greg Harrison's avatar

Exomal spike transfer between vaxed to non-vaxed now a strong likelihood according to Saneff-Mc Cullough….

sadie's avatar

That's not what the linked article said. "Dr Kevin McCairn concluded that that the pathophysiology of long covid is based on the insertion of spike protein motifs with Zika nomology that mimics HIV GP120 spike protein properties and these features were designed features in the synthetic assembly of SARS-COV-2, a deliberate insert into the biowarfare agent to initiate a specific effect, the targeting of fibrin such that a person develops the sequelae of long COVID, which is characterized by extreme fatigue and neuropathy."

Also -- 90% of blood sent to McCairn is infected.

Cruising Economist's avatar

I could be wrong but is sounds like those who didn't get COVID injections aren't suffering from the "white clots" which suggests they may be spared from potential misfolded prion consequences. Time will tell.

Neo's avatar

I love scientific conclusions smothered in scientific nomenclature and fraud. It's par for >70% of the coarse.

https://substack.com/@neomicroscopy/note/c-111222647?utm_source=notes-share-action&r=1yb1yj

https://substack.com/@neomicroscopy/note/c-111092523

He's calling CBD fibers that are in all humans, amyloids for $150 and a slide exposed to open air(the fibers are in the air) ,no slide cover, with your blood on it mailed to him.

IT'S A FALSE POSITIVE! you really think 90% of the humans have beta amyloid neurodegeneration?

https://open.substack.com/pub/neomicroscopy/p/neuroscientist-kevin-mccairn-phd?r=1yb1yj&utm_campaign=post&utm_medium=web&showWelcomeOnShare=false

Why are all the embalmers and surgeons not loosing their minds? Maybe if the surgeon is vxd..but ask John O'Looney if he feels more Looney than normal.

Greg Harrison's avatar

His edification of Dr Steven Quay’s August 2024 paper is spot on confirming bio-engineered components

Ingrid's avatar

“…the authorities say ‘prove it,’ while simultaneously refusing to investigate “…. EXACTLY the PROBLEM!!!!!!! They can always refute the evidence even when it is obvious if has never been PROVEN…DENY, DENY, DENY…classic DENY everything, admit nothing and start counter accusations

Eccentrik's avatar

"self-amplifying mRNA" could end up reaaallly compounding this problem

GB HeBe's avatar

Waiting for the mRNA "solution" to prion diseases.

Eccentrik's avatar

lol yes, along with their "cure" for cancer and every other disease they create

s r's avatar

It will and everyone will have it

Donald Schuler's avatar

Thanks for the article. I have experienced the symptoms and actively detox because I am in a public job. I gave a cousin who has been very sick from this. Another couple we know had their blood under a microscope by a doctor and found definite evidence. They started a detailed protocol and their health is improving. They were not vaccinated and they had definite structures in their blood.

Deborah Weaver's avatar

You should see articles on Substack by Dr. Ana Maria Mihalcea. She claims EDTA with high vitamin C following an overnight detox at least temporarily disintigrates the structures she sees building in the blood of both the vaccinated and unvaccinated. Good luck to you and your friends!

Peter Patreon's avatar

I wonder if you are going to say that in some people the high charges of the spike protein act as connective links to assorted brain proteins which results in a larger sized protein, that when the brain deep sleeps and spinal fluid comes into the brain to flush out the proteins that build up in the day, these big assemblies of proteins are too big to get flushed out which gives symptoms of CJD.

Greg Harrison's avatar

Because Dr Mc Cairn has incredible scientific acumen with strict adherence to the proven scientific method - his findings though cautious should be understood due to amyloid content confirmed beyond doubt - the longer term implications may likely impact over the years ahead….this is ‘The Long March’…wake up all…pls

mejbcart's avatar

from the master of prions:

https://pmc.ncbi.nlm.nih.gov/articles/PMC33918/pdf/pq013363.pdf

Proc. Natl. Acad. Sci. USA

Vol. 95, pp. 13363–13383, November 1998

Nobel Lecture

Prions

S TANLEY B. P RUSINER †

what SPike has in common with the human PrP? Just few sections, with format being a problem, as always:

Query 16 GQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGW--GQPHGGGWGQP 66

+P + + G+ + +G G Q G P

Sbjct 810 SKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLP 862

that's all what BLAST gives. But here by hand when concentrating on the glutamine instead of Glycine=G :

GQPHGGGWGQPHGGGWGQPHGGGWG-QPHGGGWG------QPHGGGWGQPHGGGWGQP

TQNVLYEN-QKLIAN--QFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDI

the format is not helping, but the overlap of all the:

Glutamines =Q (Gln 2-Amino-4-carbamoylbutanoic acid)

where every 7th residue in human prions is a glutamine, in addition to the GGGW repeats, is there... After the last overlapping Q there is the very well known segment SSNFGAISS, the s.c. islet amyloid polypeptide ( amyloidogenic sequence)...

To get to this HUGE amount of white clots all over the body, there needs to be a CONSTANT Spike production in huge amounts on the inner site of blood vessels, directly influencing fibrin.. Well, thanks to the never dying mod mRNA (Weissman+Kariko : “mRNA: Fulfilling the Promise of Gene Therapy” at https://www.cell.com/molecular-therapy-family/molecular-therapy/fulltext/S1525-0016(16)30267-2) that's where the SPike comes from, I do believe....

Personally have VERY bad image of Dr. Prusiner, who is using name of a DEAD scientist for one of his publications, 4 YEARS after the death. How can anyone do any corrections in case of disagreement? Once you are dead, you can't..

Try to find his ALL publications on google scholar, good luck boody.

Greg Harrison's avatar

The implications point to a previously unrecognised blood-borne Systemic Amyloidosis not seen before 2020…the embalmers white clots are confirmed amyloid having agglomerated from amyloid microclots as determined by Dr Resia Pretorius

Pushkin's avatar

Stephanie Seneff discussed prions in a paper Possible Unintended Consequences of COVID 19 vaccine , a paper she produced very early in the rollout of the vaccine.

mejbcart's avatar

I registered for the rumble discussions by Dr. Kevin McKairn which are extremely long, full of nightmare music, videos of anything but science, and the chat room is full of some kind of derailed shills, which take not one question seriously... Kevin responds sometimes, but not in depth... It must be possibly only me, again.... Unless it is all AI play, a targeted one.

One thing driven me really crazy, the entire covid crimes were out there, FREE of CHARGE, like the jabs, and now in order to find any help, any clue, everyone requests MONEY?? SCUMBAGS!

Neo's avatar

I don't accept payment from my paid subscribers.

You might check my SS posts for a more defined view of the Calamari Clotz.

I'm glad you saw the joke of a bombastic simpleton trying to play glorified lab tech.

i hope you have the scientific acumen or just gut instinct to know what a joke it is.

I had to watch it to see his limited perspectives.

That's not fibrin either. You will know this if you look at my Klot micrographs and know fibrin expression.

Everyone is looking for a canned hero.

https://open.substack.com/pub/neomicroscopy/p/fiberous-embalmer-clots-worldwide?r=1yb1yj&utm_campaign=post&utm_medium=web&showWelcomeOnShare=false

PandoraChaser's avatar

Could you tell me anything about the possible use of HOCL Hypochlorous acid with regards to potential prions and if such maybe of use with the vaccines claimed spike protein, and perhaps with meats, if they move to mRNA injecting livestock and it taints meat sources please?

PandoraChaser's avatar

Thanks for your links Neo. I take it HOCL is useful then, as I was going from an accidental finding when looking into Prions a few years back when Dr Flemming was banging on about the Spikes deliberate misfolded nature and I recalled they are even autoclave proof from my prior dental work. I stumbled eventually on a mere sentence somewhere suggesting HOCL had been discovered to render prions harmless and then food this series of food industry studies here:

https://hocl.com/research-industry-display?industry=Food&application=Meat

https://hocl.com/research-search-display?search=Poultry

https://hocl.com/research-search-display?search=covid (not that I think Covid is a real virus, but the claimed spike, a synthetic deliberate prion protein weapon within the jabs, whilst the plandemic, smacks of merely a fake PCR testdemic, with iatrogenic mass medical murder protocols such as ventilators, VAP denied antibiotics, midazolam+opiate cocktails, or remdesivir or similar tactics in different countries as their covid protocols, as the real killer)

Having a defense against the jabs seeming shedding of "spike", which seems to be possible via the DNA Plasmid and SV40 promotors with possible DNA integration as posited by Dr Kevin McKiernan I believe, rather than McCairn, seemed wise to search for. So I am pleased you are confirming HOCL may well have a valid role. I did approach Dr McCairn on his streaming platform with the HOCL studies linked above but he seemed extremely disinterested and almost feigned unawareness of such Food Industry standards.

Anyway Neo, thanks for the links and I shall watch the many videos within tomorrow as it hella late in U.K already. Thanks for your replay and Happy St Georges Day if that is a thing where you are :)

Namaste & Inlak'ech

Neo's avatar

Thank you PC!!

It's best to have all perspectives.

Even in investing, you need to know how the shorts are thinking compared to the longs investment strategies before you bet.

You can't tell McCairn anything. Even if he knows he's wrong and you're correct.

https://open.substack.com/pub/neomicroscopy/p/neuroscientist-kevin-mccairn-phd?r=1yb1yj&utm_campaign=post&utm_medium=web&showWelcomeOnShare=false

Neo's avatar

He's has a high transfection and colony load.

That's why he is constantly itching in the video

Here i demonstrate the etiology of the itch on a submicron level.

This is what is moving under the epidermis that causes the itch.

Everyone has this at varied degrees and it's easy to prove this with the right acumen and equipment

https://open.substack.com/pub/neomicroscopy/p/alert-morgellons-sub-micron-scientific?r=1yb1yj&utm_campaign=post&utm_medium=web&showWelcomeOnShare=false

s r's avatar

💯 a plandemic!