Thank You both a LOT for the so awaited new information! Wishing Dr. Chetty lot of strength to fight for the truth and with that for a final justice across the entire planet!
While on the topic of viruses, mixtures of genes, proteins, lipids, ligands.. What we have, ever since the first trials of the covid-19 genetically modifying injections in 2020, is a globally injected synthetic gene, possibly never disappearing. Personally I do believe that is the entire problem, the universally injected SYNTHETIC SPIKE gene, expressing the final toxin, while using human body parts, and replicating itself... I'll leave the ORF10 theory out of a scope, this is too little of a protein to do a big damage, just my opinion, or ignorance, sorry...
To replicate a virus, one needs human blood, and that is not, what a waste water is, which DOES NOT CONTAIN the building blocks to assemble the final viral monster, only the injections reach the blood, use humans to spread...
From all my personal observations, only confirming what you both are saying in terms of really concerning health effects, a facit can be drawn, this stuff, the GENETIC CODE, is indeed VERY dangerous, and prevalent. Dr. Chetty mentions the tip of it, the staph. enterotoxin B (SEB) , which apparently is stimulated by the Spike, but what I see here, pieces if the Spike are itself a part of it(!...), here quick BLAST search(sorry the format does not allow good overview of the message):
and few more of ~40 residues spanning sections, very homolog to that relatively small staph toxin.. This part shown above here is a part of ACE2 receptor binding domain, maybe that's why "A monoclonal antibody against staphylococcal enterotoxin B superantigen inhibits SARS-CoV-2 entry in vitro" (https://www.cell.com/structure/fulltext/S0969-2126(21)00121-0). It is as if sharing the same parts binding to the ACE2 receptor, potentiates the outcome of both, and having anything preventing that binding will rescue from both.
Whoever, or WHATever designed that entire spike sequence, was/is 'superintelligent' criminal MONSTER. Just my own observation, targeted people (the specifically genetically underprivileged) need to watch 5G, wi-fi AND anything what is common with Kaiser Permanente, hospitals, etc...
(2 Timothy 3:16) All Scripture is inspired of God and beneficial for teaching, for reproving, for setting things straight, for disciplining in righteousness,
so Bible writers were inspired...when I hear of this bio-wea-pons capabilities and scientists are still discovering new stuff coming out of their research, I am inclined to say that these deranged evil psychopaths in their labs, were inspired of Satan. Satan the rebellious angel turned against his Creator and vowed to destroy all creations....he is getting pretty close but God is still in control and has promised to intervene and it will be soon or else...
(Matthew 24:22) In fact, unless those days were cut short, no flesh would be saved; but on account of the chosen ones those days will be cut short.
(Revelation 6:8) And I saw, and look! a pale horse, and the one seated on it had the name Death. And the Grave was closely following him. And authority was given them over the fourth part of the earth, to kill with a long sword and with food shortage and with deadly plague and by the wild beasts of the earth.
one fourth of the earth will die...sickening but better than the 7 billions useless eaters they wanted to cull
in my opinion, silence makes you an accomplice...we will ALL have to render an accounting when we stand before our Maker, very soon. He has equipped us ALL with a conscience, which conscience SHOULD STOP us from committing wrong things, or harm our fellow human beings...pity...we should FEAR HIM before we fear man...our Eternal life is in the balance...loosing that would be so sad...for what? to keep your jobs for a few more years and then gone forever?...this reminds me of the the plea Moses addressed to the Nation of Israel
(Luke 12:4, 5) Moreover, I say to you, my friends, do not fear those who kill the body and after this are not able to do anything more. 5 But I will show you whom to fear: Fear the One who after killing has authority to throw into Ge·henʹna. Yes, I tell you, fear this One.
(Hebrews 10:31) It is a fearful thing to fall into the hands of the living God.
(Deuteronomy 30:19) I take the heavens and the earth as witnesses against you today that I have put life and death before you, the blessing and the curse; and you must choose life so that you may live, you and your descendants,
It is not over yet, but it is coming very fast, so people can still change course and do the right thing...He is a merciful God...Chose LIFE!
your comment brought me to tears, in the context of these words form the bible, when thinking about my uncle, who while turning ~80 and being devoted Christian, committed suicide after the 4th covid jab...
Dr Charles Hoffe here in Canada was exonerated recently when the B.C. college of physicians and surgeons recoiled their charges against him. He too had expert witnesses in place pro bono.
In his victory speech he said “The truth is like a lion it does not need defending. Let it loose and it will defend itself.”
It was an app for him and you as he is from South Africa as well
if the 'vaccine' prototype was finished by Moderna on 13th of Jan 2020, then it is obvious, they knew the sequence, they knew the plan how to universally genetically modify the entire world population with one and the same sequence via injections! The pandemic, to my knowledge was not 'visible' so much until the begin of 2021 (except for really BAD flu in the winter of 2019-begin of 2020), which started with the injections.
It is interesting, that Rixey speaks mainly about the furin site (like Deigin, a russian scientist), while never mentioning the equally important feature of SPike, the 'RGD' motif, basics of synthetic biology, essential for integrins, and venoms research... Wrote about it in this post:
maybe not that well written, but still, with lot of evidence of direct harm to HUMAN beings.
Also one could add to Rixey's list this part of SPike which is equally homolog to the prion portion shown in his table:
SVASQSII--AYTM <<= Charles Rixey prion like motif no I in Spike2020
YVTQQ-LIRA-AEI <<< SPIKE prion-like motif no II in Spike2020
-VAQQNLIVSNTEG <<<Plaqoglobin (1994)*
*"2 homologs of 1994 "Identification of amino acid sequence motifs in desmocollin, a desmosomal glycoprotein, that are required for plakoglobin binding and plaque formation"
it looks like with the time and more gain of functions, the number of plaque building blocks within Spike grew...
Dr McMillion (or Substack readers) which talk did you do that mentioned prion proteins? We recently had a health department notice of 3 cases of Creutzfeldt Jakob disease.
Excellent. For one avenue of fresh political thinking and political response to the suppression of this story, and others, see my new solo substack, Dissident Conservative. https://dissidentcon.substack.com/
The deception and lies must never be allowed to fade from our consciousness of what was and still is the greatest Experiment known. The truth must be sought and declared worldwide.
✨ I highly suggest it, not only for yourself, but the doctor you interviewed that has to go to trial to keep his medical license. 💡 So, he has created not a product I believe this company is called bio lab bioscience, but it was an injection, but very promising I lt completely gets rid of cancer, pike protein & completely repairs the damaged T cells COVID-19 vaccination-like protein and everything out of your body. It's a must see✔️
Dr. Patrick Soon-Shiong! 📚 You're being lied to about cancer, how it's caused, and how to stop it! 🚫 Safe, I promise you that. Please send this to your doctor that you interviewed who's going on trial. I believe that's Dr. Patrick Soon-Shiong! 🧠 You're being lied to about cancer, how it's caused, and how to stop it! 🌟
That genes specific 'choice' by the Spike's designers speaks for itself... I did some analysis on it too, after hearing from Dr. Lee Meritt about it, and was shocked, posted it at:
What is comes down to is, that delivering the Spike/SARS-CoV-2 virus to populations like: East Asian, South Asian, African and African American, European, European and South Asian populations, will make them sick, while the Ashkenazi Jewish population is protected. A scientific article on this topic was published in Biochem Biophys Rep. 2020 Dec; 24: 100798, its title:”ACE2 coding variants in different populations and their potential impact on SARS-CoV-2 binding affinity” accessible at: https://pubmed.ncbi.nlm.nih.gov/32844124/. That topic was also covered at: https://www.jebms.org/full-text/30 in yet another 2020 article titled:”Effects of Human Genetic Factors (Ethnicity and Race) on Clinical Severity of SARS-CoV-2 (COVID-19” and in the 2021 Nature article at: https://www.nature.com/articles/s42003-021-02030-3 with an article titled:”Human ACE2 receptor polymorphisms and altered susceptibility to SARS-CoV-2”.
another superb expose and interview...Thank you so much...praying for the end of this evil madness...every front line freedom fighter is getting tired...we are involved in this battle between good and bad between the Creator and his Rebellious angel, Satan
(Deuteronomy 32:35) Vengeance is mine, and retribution, At the appointed time when their foot slips, For the day of their disaster is near, And what awaits them will come quickly.’
(Psalm 37:10, 11) Just a little while longer, and the wicked will be no more; You will look at where they were, And they will not be there.
(Psalm 37:11) But the meek will possess the earth, And they will find exquisite delight in the abundance of peace.
(Psalm 37:29) The righteous will possess the earth, And they will live forever on it.
Thank you Dr. McMillan. So much truth - so beautifully said. God bless you and Dr. Chetty. 🙏🙏🙏
Thank you Dr. Phillip McMillan.
Dr. Chetty is sincere, truly caring for the wellbeing of people. He risked his life and profession for the sake of oath he took just like you.
Keep up. Do not yield. My prayer to both of you for the service doing to mankind.
Regards.
I loved seeing Dr. Chetty again on your show!
Thank You both a LOT for the so awaited new information! Wishing Dr. Chetty lot of strength to fight for the truth and with that for a final justice across the entire planet!
While on the topic of viruses, mixtures of genes, proteins, lipids, ligands.. What we have, ever since the first trials of the covid-19 genetically modifying injections in 2020, is a globally injected synthetic gene, possibly never disappearing. Personally I do believe that is the entire problem, the universally injected SYNTHETIC SPIKE gene, expressing the final toxin, while using human body parts, and replicating itself... I'll leave the ORF10 theory out of a scope, this is too little of a protein to do a big damage, just my opinion, or ignorance, sorry...
To replicate a virus, one needs human blood, and that is not, what a waste water is, which DOES NOT CONTAIN the building blocks to assemble the final viral monster, only the injections reach the blood, use humans to spread...
From all my personal observations, only confirming what you both are saying in terms of really concerning health effects, a facit can be drawn, this stuff, the GENETIC CODE, is indeed VERY dangerous, and prevalent. Dr. Chetty mentions the tip of it, the staph. enterotoxin B (SEB) , which apparently is stimulated by the Spike, but what I see here, pieces if the Spike are itself a part of it(!...), here quick BLAST search(sorry the format does not allow good overview of the message):
Query 70 DTKLG-NYDNV-RVEFKNKDLADKYKDKYVDVFGANYY-------YQCYF 110 <=SEB
____________D+K+G NY+ + R+_F+ +L +D +++ A + CYF
Sbjct 442 DSKVGGNYNYLYRL-FRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYF 490 <=Spike
and few more of ~40 residues spanning sections, very homolog to that relatively small staph toxin.. This part shown above here is a part of ACE2 receptor binding domain, maybe that's why "A monoclonal antibody against staphylococcal enterotoxin B superantigen inhibits SARS-CoV-2 entry in vitro" (https://www.cell.com/structure/fulltext/S0969-2126(21)00121-0). It is as if sharing the same parts binding to the ACE2 receptor, potentiates the outcome of both, and having anything preventing that binding will rescue from both.
Whoever, or WHATever designed that entire spike sequence, was/is 'superintelligent' criminal MONSTER. Just my own observation, targeted people (the specifically genetically underprivileged) need to watch 5G, wi-fi AND anything what is common with Kaiser Permanente, hospitals, etc...
the Bible is inspired of God
(2 Timothy 3:16) All Scripture is inspired of God and beneficial for teaching, for reproving, for setting things straight, for disciplining in righteousness,
so Bible writers were inspired...when I hear of this bio-wea-pons capabilities and scientists are still discovering new stuff coming out of their research, I am inclined to say that these deranged evil psychopaths in their labs, were inspired of Satan. Satan the rebellious angel turned against his Creator and vowed to destroy all creations....he is getting pretty close but God is still in control and has promised to intervene and it will be soon or else...
(Matthew 24:22) In fact, unless those days were cut short, no flesh would be saved; but on account of the chosen ones those days will be cut short.
(Revelation 6:8) And I saw, and look! a pale horse, and the one seated on it had the name Death. And the Grave was closely following him. And authority was given them over the fourth part of the earth, to kill with a long sword and with food shortage and with deadly plague and by the wild beasts of the earth.
one fourth of the earth will die...sickening but better than the 7 billions useless eaters they wanted to cull
in my opinion, silence makes you an accomplice...we will ALL have to render an accounting when we stand before our Maker, very soon. He has equipped us ALL with a conscience, which conscience SHOULD STOP us from committing wrong things, or harm our fellow human beings...pity...we should FEAR HIM before we fear man...our Eternal life is in the balance...loosing that would be so sad...for what? to keep your jobs for a few more years and then gone forever?...this reminds me of the the plea Moses addressed to the Nation of Israel
(Luke 12:4, 5) Moreover, I say to you, my friends, do not fear those who kill the body and after this are not able to do anything more. 5 But I will show you whom to fear: Fear the One who after killing has authority to throw into Ge·henʹna. Yes, I tell you, fear this One.
(Hebrews 10:31) It is a fearful thing to fall into the hands of the living God.
(Deuteronomy 30:19) I take the heavens and the earth as witnesses against you today that I have put life and death before you, the blessing and the curse; and you must choose life so that you may live, you and your descendants,
It is not over yet, but it is coming very fast, so people can still change course and do the right thing...He is a merciful God...Chose LIFE!
your comment brought me to tears, in the context of these words form the bible, when thinking about my uncle, who while turning ~80 and being devoted Christian, committed suicide after the 4th covid jab...
I am not sure I understand why it brought you to tears ....what led your uncle to commit suicide?...can you explain?
Dr Charles Hoffe here in Canada was exonerated recently when the B.C. college of physicians and surgeons recoiled their charges against him. He too had expert witnesses in place pro bono.
In his victory speech he said “The truth is like a lion it does not need defending. Let it loose and it will defend itself.”
It was an app for him and you as he is from South Africa as well
if the 'vaccine' prototype was finished by Moderna on 13th of Jan 2020, then it is obvious, they knew the sequence, they knew the plan how to universally genetically modify the entire world population with one and the same sequence via injections! The pandemic, to my knowledge was not 'visible' so much until the begin of 2021 (except for really BAD flu in the winter of 2019-begin of 2020), which started with the injections.
It is interesting, that Rixey speaks mainly about the furin site (like Deigin, a russian scientist), while never mentioning the equally important feature of SPike, the 'RGD' motif, basics of synthetic biology, essential for integrins, and venoms research... Wrote about it in this post:
https://mejbcart.substack.com/p/dr-bret-weinstein-yuri-deigin-and
maybe not that well written, but still, with lot of evidence of direct harm to HUMAN beings.
Also one could add to Rixey's list this part of SPike which is equally homolog to the prion portion shown in his table:
SVASQSII--AYTM <<= Charles Rixey prion like motif no I in Spike2020
YVTQQ-LIRA-AEI <<< SPIKE prion-like motif no II in Spike2020
-VAQQNLIVSNTEG <<<Plaqoglobin (1994)*
*"2 homologs of 1994 "Identification of amino acid sequence motifs in desmocollin, a desmosomal glycoprotein, that are required for plakoglobin binding and plaque formation"
it looks like with the time and more gain of functions, the number of plaque building blocks within Spike grew...
Virus?, do we have ACE-2 receptors in our lungs?
Dr McMillion (or Substack readers) which talk did you do that mentioned prion proteins? We recently had a health department notice of 3 cases of Creutzfeldt Jakob disease.
Dr Chetty is my hero. His evidence saved me from getting the poison and I will always be immensely grateful to this Doctor for speaking out. 👍❤️❤️❤️
Excellent. For one avenue of fresh political thinking and political response to the suppression of this story, and others, see my new solo substack, Dissident Conservative. https://dissidentcon.substack.com/
Excellent talk! Would love to hear more on what the current line of thinking is for an antidote. I’ve pieced some things together from other talks.
The deception and lies must never be allowed to fade from our consciousness of what was and still is the greatest Experiment known. The truth must be sought and declared worldwide.
✨ I highly suggest it, not only for yourself, but the doctor you interviewed that has to go to trial to keep his medical license. 💡 So, he has created not a product I believe this company is called bio lab bioscience, but it was an injection, but very promising I lt completely gets rid of cancer, pike protein & completely repairs the damaged T cells COVID-19 vaccination-like protein and everything out of your body. It's a must see✔️
Dr. Patrick Soon-Shiong! 📚 You're being lied to about cancer, how it's caused, and how to stop it! 🚫 Safe, I promise you that. Please send this to your doctor that you interviewed who's going on trial. I believe that's Dr. Patrick Soon-Shiong! 🧠 You're being lied to about cancer, how it's caused, and how to stop it! 🌟
https://tuckercarlson.com/tucker-show-patrick-soon
That genes specific 'choice' by the Spike's designers speaks for itself... I did some analysis on it too, after hearing from Dr. Lee Meritt about it, and was shocked, posted it at:
https://mejbcart.substack.com/p/ctcctcg-gcggg-cacgtag-and-the-five
small quote from it:
What is comes down to is, that delivering the Spike/SARS-CoV-2 virus to populations like: East Asian, South Asian, African and African American, European, European and South Asian populations, will make them sick, while the Ashkenazi Jewish population is protected. A scientific article on this topic was published in Biochem Biophys Rep. 2020 Dec; 24: 100798, its title:”ACE2 coding variants in different populations and their potential impact on SARS-CoV-2 binding affinity” accessible at: https://pubmed.ncbi.nlm.nih.gov/32844124/. That topic was also covered at: https://www.jebms.org/full-text/30 in yet another 2020 article titled:”Effects of Human Genetic Factors (Ethnicity and Race) on Clinical Severity of SARS-CoV-2 (COVID-19” and in the 2021 Nature article at: https://www.nature.com/articles/s42003-021-02030-3 with an article titled:”Human ACE2 receptor polymorphisms and altered susceptibility to SARS-CoV-2”.
another superb expose and interview...Thank you so much...praying for the end of this evil madness...every front line freedom fighter is getting tired...we are involved in this battle between good and bad between the Creator and his Rebellious angel, Satan
(Deuteronomy 32:35) Vengeance is mine, and retribution, At the appointed time when their foot slips, For the day of their disaster is near, And what awaits them will come quickly.’
(Psalm 37:10, 11) Just a little while longer, and the wicked will be no more; You will look at where they were, And they will not be there.
(Psalm 37:11) But the meek will possess the earth, And they will find exquisite delight in the abundance of peace.
(Psalm 37:29) The righteous will possess the earth, And they will live forever on it.
see you soon on a beach in the restored Paradise!